Attention une mise à jour du serveur va être effectuée le lundi 17 mai entre 13h et 13h30. Cette mise à jour va générer une interruption du service de quelques minutes.

Commit 549fc6bb authored by Mathieu Giraud's avatar Mathieu Giraud

tool/tests/data: some test files in .vidjil.gz and .tsv.gz

see #xxxx
parent d0959315
sequence_id sequence locus stop_codon vj_in_frame productive rev_comp v_call d_call j_call sequence_alignment germline_alignment sequence_alignment_aa germline_alignment_aa v_alignment_start v_alignment_end d_alignment_start d_alignment_end j_alignment_start j_alignment_end v_sequence_alignment v_sequence_alignment_aa v_germline_alignment v_germline_alignment_aa d_sequence_alignment d_sequence_alignment_aa d_germline_alignment d_germline_alignment_aa j_sequence_alignment j_sequence_alignment_aa j_germline_alignment j_germline_alignment_aa fwr1 fwr1_aa cdr1 cdr1_aa fwr2 fwr2_aa cdr2 cdr2_aa fwr3 fwr3_aa cdr3 cdr3_aa junction junction_length junction_aa junction_aa_length v_score d_score j_score v_cigar d_cigar j_cigar v_support d_support j_support v_identity d_identity j_identity v_sequence_start v_sequence_end v_germline_start v_germline_end d_sequence_start d_sequence_end d_germline_start d_germline_end j_sequence_start j_sequence_end j_germline_start j_germline_end fwr1_start fwr1_end cdr1_start cdr1_end fwr2_start fwr2_end cdr2_start cdr2_end fwr3_start fwr3_end cdr3_start cdr3_end np1 np1_length np2 np2_length
IGHV3-74*02 GGAGTCGGGGGGAGGCTTAGTTCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTACTGGATGCACTGGGTCCGCCAAGCTCCAGGGAAGGGGCTGGTGTGGGTCTCACGTATTAATAGTGATGGGAGTAGCACAAGCTACGCGGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTGCAAATGAACAGTCTGAGAGCCGAGGACACGGCTGTGTATTACTGCCGCGGTCGATATTTTGACTGGTTATTACTTCGAACATGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGT IGH T F F F IGHV3-74*01,IGHV3-74*02 IGHD3-9*01 IGHJ4*02 GGAGTCGGGGGGAGGCTTAGTTCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTACTGGATGCACTGGGTCCGCCAAGCTCCAGGGAAGGGGCTGGTGTGGGTCTCACGTATTAATAGTGATGGGAGTAGCACAAGCTACGCGGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTGCAAATGAACAGTCTGAGAGCCGAGGACACGGCTGTGTATTACTGCCGCGGTCGATATTTTGACTGGTTATTACTTCGAACATGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAG GGAGTCCGGGGGAGGCTTAGTTCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTACTGGATGCACTGGGTCCGCCAAGCTCCAGGGAAGGGGCTGGTGTGGGTCTCACGTATTAATAGTGATGGGAGTAGCACAAGCTACGCGGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTGCAAATGAACAGTCTGAGAGCCGAGGACACGGCTGTGTATTACTGNNNNNNNCGATATTTTGACTGGTTATTANNNNNNNNNTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAG ESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCRGRYFDWLLLRT*LLGPGNPGHRLL ESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYXXXRYFDWLLXXX*LLGPGNPGHRLL 1 273 281 301 311 351 GGAGTCGGGGGGAGGCTTAGTTCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTACTGGATGCACTGGGTCCGCCAAGCTCCAGGGAAGGGGCTGGTGTGGGTCTCACGTATTAATAGTGATGGGAGTAGCACAAGCTACGCGGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTGCAAATGAACAGTCTGAGAGCCGAGGACACGGCTGTGTATTACTG ESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYY GGAGTCCGGGGGAGGCTTAGTTCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTACTGGATGCACTGGGTCCGCCAAGCTCCAGGGAAGGGGCTGGTGTGGGTCTCACGTATTAATAGTGATGGGAGTAGCACAAGCTACGCGGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTGCAAATGAACAGTCTGAGAGCCGAGGACACGGCTGTGTATTACTG ESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYY CGATATTTTGACTGGTTATTA RYFDWLL CGATATTTTGACTGGTTATTA RYFDWLL TGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAG *LLGPGNPGHRLL TGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAG *LLGPGNPGHRLL GGAGTCGGGGGGAGGCTTAGTTCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCT ESGGGLVQPGGSLRLSCAAS GGATTCACCTTCAGTAGCTACTGG GFTFSSYW ATGCACTGGGTCCGCCAAGCTCCAGGGAAGGGGCTGGTGTGGGTCTCACGT MHWVRQAPGKGLVWVSR ATTAATAGTGATGGGAGTAGCACA INSDGSST AGCTACGCGGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACGCTGTATCTGCAAATGAACAGTCTGAGAGCCGAGGACACGGCTGTGTATTACTGC SYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYC CGCGGTCGATATTTTGACTGGTTATTACTTCGAACATGACTAC RGRYFDWLLLRT*L TGCCGCGGTCGATATTTTGACTGGTTATTACTTCGAACATGACTACTGG 49 CRGRYFDWLLLRT*LL 16 424.084 41.064 79.518 14N273M80S9N 280S6N21M52S4N 310S7N41M2S 9.777e-121 7.282e-08 4.384e-19 99.634 100.000 100.000 1 273 15 287 281 301 7 27 311 351 8 48 1 61 62 85 86 136 137 160 161 274 275 317 CCGCGGT 7 CTTCGAACA 9
IGHD6-13*01_8/TCCCCCCCCCCT/6_IGHJ1*01__IGH+ ATACGAGATATGGACAGATTACGGTAGCAGAGACTTGGTCTTGACCCCAGCAAGGGAAGGCCCCCAAACAGACCAGGAGGTTTCTGAAGGTGTCTGTGTCACAGTGGGGTATAGCAGCATCCCCCCCCCCTTACTTCCAGCACTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCAGGTAAG IGL F F IGLV4-60*01,IGLV4-60*02,IGLV4-60*03 CAGCAAGGGAAGGCCCC CAGCCAGGGAAGGCCCC QQGKAP QPGKAP 1 17 CAGCAAGGGAAGGCCCC QQGKAP CAGCCAGGGAAGGCCCC QPGKAP CAGCAAGGGAAGGCCCC QQGKAP 25.208 47S114N17M118S166N 5.603e-01 94.118 48 64 115 131 48 64
IGKV1-5*03 CTCCTGCTACTCTGGCTCCCAGGTGCCAAATGTGACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCGTCTGTAGGAGACAGAGTCACCATCACCTGCCGGGCCAGTCAGAGTATTAATAACAACTTGGCCTGGTATCAGGAGAAGCCAGGGAAAGCCCCTAAGGTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACCTATTACTGCCAACAATATAATAGACTTTGGACGTTCGGCCAAGGGACCAAGGTGGAAGTCAAACGAACTGTGGCTGCACCATCT IGK F T T F IGKV1-5*03 IGKJ1*01 GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCGTCTGTAGGAGACAGAGTCACCATCACCTGCCGGGCCAGTCAGAGTATTAATAACAACTTGGCCTGGTATCAGGAGAAGCCAGGGAAAGCCCCTAAGGTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACCTATTACTGCCAACAATATAATAGACTTTGGACGTTCGGCCAAGGGACCAAGGTGGAAGTCAAAC GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACTTATTACTGCCAACAGTATAATAGNNNNTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAAC DIQMTQSPSTLSASVGDRVTITCRASQSINNNLAWYQEKPGKAPKVLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNRLWTFGQGTKVEVK DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNXXWTFGQGTKVEIK 1 278 283 319 GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCGTCTGTAGGAGACAGAGTCACCATCACCTGCCGGGCCAGTCAGAGTATTAATAACAACTTGGCCTGGTATCAGGAGAAGCCAGGGAAAGCCCCTAAGGTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACCTATTACTGCCAACAATATAATAG DIQMTQSPSTLSASVGDRVTITCRASQSINNNLAWYQEKPGKAPKVLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYN GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATAAGGCGTCTAGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACTTATTACTGCCAACAGTATAATAG DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYN TGGACGTTCGGCCAAGGGACCAAGGTGGAAGTCAAAC WTFGQGTKVEVK TGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAAC WTFGQGTKVEIK GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCGTCTGTAGGAGACAGAGTCACCATCACCTGCCGGGCCAGT DIQMTQSPSTLSASVGDRVTITCRAS CAGAGTATTAATAACAAC QSINNN TTGGCCTGGTATCAGGAGAAGCCAGGGAAAGCCCCTAAGGTCCTGATCTAT LAWYQEKPGKAPKVLIY AAGGCGTCT KAS AGTTTAGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCCTGCAGCCTGATGATTTTGCAACCTATTACTGC SLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYC CAACAATATAATAGACTTTGGACG QQYNRLWT TGCCAACAATATAATAGACTTTGGACGTTC 30 CQQYNRLWTF 10 397.597 66.059 33S278M61S9N 315S1N37M20S 9.739e-113 5.045e-15 95.683 97.297 34 311 1 278 316 352 2 38 34 111 112 129 130 180 181 189 190 297 298 321 ACTT 4
Intron CGTGGCACCGCGAGCTGTAGACAGAGCCGCGGTCTTTCTCGATTGAGTGGCTTTGGTGGCCATGCCACCGCGCTCTTGGGGCAGCCGCCTTGCCGCTAGTGGCCGTGGCCACCCTGTGTCTGCCCGATTGATGCTGCCGTAGCCAGCTTTCCTGAGTGGCAGCCCAGGGCGACTCCTCATGAGTCTGCAGCTGCATTTTTGCCATATCCACTATTTGGAGTCTGACCTCCCTAGGAAGCCTCCCTGCTCCCTAGGACAACCTGCTCTGACCTCTGAGG IGK T F F IGKV6D-41*01 TGATGCTGCCGTAGCCAGCTTTCCTGAGTGGCAGCCCAGGG TGATGACACAGTCTCCAGCTTTCCTCTCTGTGACTCCAGGG MLP*PAFLSGSPG MTQSPAFLSVTPG 1 41 TGATGCTGCCGTAGCCAGCTTTCCTGAGTGGCAGCCCAGGG MLP*PAFLSGSPG TGATGACACAGTCTCCAGCTTTCCTCTCTGTGACTCCAGGG MTQSPAFLSVTPG TGATGCTGCCGTAGCCAGCTTTCCTGAGTGGCAGCCCAGGG MLP*PAFLSGSPG 25.208 128S7N41M109S239N 8.982e-01 68.293 129 169 8 48 129 169
IGKV3-7*04 CCCAGGCTCCTCATCTATGATGCATCCACCAGGGCCACTAGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAGTTTATTACTGTCAGCAGGATTATAACTTACCTCGTGGAGGCAGCCCAGGGCGACTCCTCATGAGTCTGCAGCTGCATTTTTGCCATATCCACTATTTGGAGTCTGACCTCCCTAGGAAGCCTCCCTGCTCCCTAGGACAACCTGCTCTGACCTCTGAGG IGK F F IGKV3-7*04 CCCAGGCTCCTCATCTATGATGCATCCACCAGGGCCACTAGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAGTTTATTACTGTCAGCAGGATTATAACTTACCTC CCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTAGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAGTTTATTACTGTCAGCAGGATTATAACTTACCTC PRLLIYDASTRATSIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP PRLLIYGASTRATSIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP 1 157 CCCAGGCTCCTCATCTATGATGCATCCACCAGGGCCACTAGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAGTTTATTACTGTCAGCAGGATTATAACTTACCTC PRLLIYDASTRATSIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP CCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTAGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAGTTTATTACTGTCAGCAGGATTATAACTTACCTC PRLLIYGASTRATSIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP CCCAGGCTCCTCATCTAT PRLLIY GATGCATCC DAS ACCAGGGCCACTAGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAGTTTATTACTGT TRATSIPARFSGSGSGTDFTLTISSLQPEDFAVYYC 243.344 132N157M126S1N 1.980e-66 99.363 1 157 133 289 1 18 19 27 28 135
IGLV2-14*01 GGTCCTGGGCCCAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACTATGTCTCCTGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCATGATTTATGAGGTCAGTAATCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGCGAGGACGAGGCTGATTATTACTGCAGCTCATATACAAGCTTTCTTGGGTGTTCGGCGGAGGGACCAAGCTG IGL F F F F IGLV2-14*01 IGLJ3*02 CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACTATGTCTCCTGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCATGATTTATGAGGTCAGTAATCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGC-GAGGACGAGGCTGATTATTACTGCAGCTCATATACAAGCTTTCTTGGGTGTTCGGCGGAGGGACCAAGCTG CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACTATGTCTCCTGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCATGATTTATGAGGTCAGTAATCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACTGCAGCTCATATACAAGCNNNNTTGGGTGTTCGGCGGAGGGACCAAGCTG QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQARTRLIITAAHIQAFLGVRRRDQA QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSXXGCSAEGPS 1 285 290 317 CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACTATGTCTCCTGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCATGATTTATGAGGTCAGTAATCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGC-GAGGACGAGGCTGATTATTACTGCAGCTCATATACAAGC QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQARTRLIITAAHIQA CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAACTATGTCTCCTGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCATGATTTATGAGGTCAGTAATCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACTGCAGCTCATATACAAGC QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTS TTGGGTGTTCGGCGGAGGGACCAAGCTG LGVRRRDQA TTGGGTGTTCGGCGGAGGGACCAAGCTG LGVRRRDQA CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGAACC QSALTQPASVSGSPGQSITISCTGT AGCAGTGACGTTGGTGGTTATAACTAT SSDVGGYNY GTCTCCTGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCATGATTTAT VSWYQQHPGKAPKLMIY GAGGTCAGT EVS AATCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGCGAGGACGAGGCTGATTATTACTGC NRPSGVSNRFSGSKSGNTASLTISGLQARTRLIITA AGCTCATATACAAGCTTTCTTGGGTG AHIQAFLG TGCAGCTCATATACAAGCTTTCTTGGGTGTTC 32 AAHIQAFLGV 10 436.549 54.523 11S245M1D39M32S12N 299S28M10N 1.591e-124 1.355e-11 99.649 100.000 12 295 1 285 300 327 1 28 12 86 87 113 114 164 165 173 174 280 281 306 TTTC 4
TRAV1-1*01 TCTTCATTCCTTAGTCGCTCTGATAGTTATGGTTACCTCCTTCTACAGGAGCTCCAGATGAAAGACTCTGCCTCTTACTTCTGCGCTGTGAGAGAGTATGAAAGTATTACCTCCCAGTTGCAATTTGGCAAAGGAACCAGAGTTTCCACTTCTCC IGK F F IGKV1-12*01,IGKV1-12*02,IGKV1D-12*01 TCCAGATGAAAGACTCTGCCTCTT TCCAGATGACCCAGTCTCCATCTT QMKDSAS QMTQSPS 1 24 TCCAGATGAAAGACTCTGCCTCTT QMKDSAS TCCAGATGACCCAGTCTCCATCTT QMTQSPS TCCAGATGAAAGACTCTGCCTCTT QMKDSAS 20.534 52S4N24M79S259N 1.183e+01 75.000 53 76 5 28 53 76
TRBV11-2*01 AACGGTGTAGTGGATGATTCACAGTTGCCTAAGGATCGATTTTCTGCAGAGAGGCTCAAAGGAGTAGACTCCACTCTCAAGATCCAGCCTGCAAAGCTTGAGGACTCGGCCGTGTATCTCTGTGCCAGCAGCTTAGGTCCCTCGTACGAGCAGTACTTCGGGCCGGGCACCAGGCTC IGH T T F F IGHV3-72*01 IGHD2-2*01,IGHD2-2*02,IGHD2-2*03 IGHJ2*01 CAGCCTGCAAAGCTTGAGGACTCGGCCGTGTATCTCTGTGCCAGCAGCTTAGGTCCCTCGTACGAGCAGTACTTCG CAGCCTGAAAACC--GAGGACACGGCCGTGTATTACTGTGCTAGCAGCTNNNNNNNNNNNNNNNNNNNGTACTTCG SLQSLRTRPCISVPAA*VPRTSSTS SLKTEDTAVYYCASSXXXXXXXYF 1 44 45 49 69 76 CAGCCTGCAAAGCTTGAGGACTCGGCCGTGTATCTCTGTGCCAG SLQSLRTRPCISVP CAGCCTGAAAACC--GAGGACACGGCCGTGTATTACTGTGCTAG SLKTEDTAVYYCA CAGCT A CAGCT A GTACTTCG TS GTACTTCG TS CAGCCTGCAAAGCTTGAGGACTCGGCCGTGTATCTCTGT SLQSLRTRPCISV GCCAGCAGCTTAGGTCCCTCGTACGAGCAGTACTTCG PAA*VPRTSSTS TGTGCCAGCAGCTTAGGTCCCTCGTACGAGCAGTACTTCGGGC 43 VPAA*VPRTSSTSG 14 39.231 10.301 16.069 84S257N13M2I29M49S3N 128S18N5M44S8N 152S6N8M17S39N 3.258e-05 6.952e+01 2.687e+00 81.818 100.000 100.000 85 128 258 299 129 133 19 23 153 160 7 14 85 123 124 160 0 TAGGTCCCTCGTACGAGCA 19
TRBD2*02 CTGCGCTTCCTGCCGCTGCCCAGTGGTTGGGGGAGGGGGACTAGCAGGGAGGAAACATTTTTGTATCATGGTGTAACATTGTGGGGACTAGTGTCAGTCCCCCTACGAGCAGTACTTCGGGCCGGGCACCAGGCTCACGGTTACAGGTAAGA F IGHV2-70*09 CACCAGGCTCAC CACCAGGCTCAC PGS PGS 1 12 CACCAGGCTCAC PGS CACCAGGCTCAC PGS 20.534 126S197N12M14S88N 1.156e+01 100.000 127 138 198 209
TRGV10*02 ATCCTTACCATCAAGTCCGTAGAGAAAGAAGACATGGCCGTTTACTACTGTGCTGCGTGGAGACCCACTGGTTGGTTCAAGATATTTGCTGAAGGGACTAAGCTCATAGTAACTT IGH F T T F IGHV1-18*03 IGHD3-9*01 IGHJ3*01,IGHJ3*02,IGHJ4*03 GAAGACATGGCCGTTTACTACTGTGCTGCGTGGAGACCCACTGGTTGGTTCAAGATATTTGCTGAAGGGAC GACGACATGGCCGTGTATTACTGTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNGATATTTNNNNAAGGGAC EDMAVYYCAAWRPTGWFKIFAEGT DDMAVYYCAXXXXXXXXXIFXXGT 1 26 54 60 65 71 GAAGACATGGCCGTTTACTACTGTGC EDMAVYYCA GACGACATGGCCGTGTATTACTGTGC DDMAVYYCA GATATTT IF GATATTT IF AAGGGAC GT AAGGGAC GT GAAGACATGGCCGTTTACTACTGT EDMAVYYC 32.999 14.146 14.146 27S264N26M62S6N 80S7N7M28S17N 91S23N7M17S20N 1.466e-03 3.052e+00 6.653e+00 88.462 100.000 100.000 28 53 265 290 81 87 8 14 92 98 24 30 28 51 TGCGTGGAGACCCACTGGTTGGTTCAA 27 GCTG 4
TRDV1*01 CAAAAAGTGGTCGCTATTCTGTCAACTTCAAGAAAGCAGCGAAATCCGTCGCCTTAACCATTTCAGCCTTACAGCTAGAAGATTCAGCAAAGTACTTTTGTGCTCTTGGGGAATCTCGATTTCCTACCGTACTGGGGGATCTCGGGACACCGATAAACTCATCTTTGGAAAAGGAACCCGTGTGACTGTGGAAC IGK F F F F IGKV2-4*01 IGKJ2*01,IGKJ2*02 ATTCAGCAAAGTACTTTTG ATTCAGCAAAGTACTTTTG FSKVLL FSKVLL 1 12 13 19 ATTCAGCAAAGT FSKV ATTCAGCAAAGT FSKV ACTTTTG LL ACTTTTG LL ATTCAGCAAAGTACTTTTG FSKVLL 20.534 14.146 81S236N12M101S54N 93S5N7M94S27N 1.526e+01 1.122e+01 100.000 100.000 82 93 237 248 94 100 6 12 82 100 0
TRDD2 GAGGGAAGCTGCTTGCTGTGTTTGTCTCCTGAGGCATGGGACCCAGGGTGAGGATATCCCAGGGAAATGGCACTTTTGCCCCTGCAGTTTTTGTACAGGTCTCTGTAGGTTTTGTAGCACTGCCATAGGAAGGCACAATGAAACACATCAGTATAAAAACCCTCTTCTTCCTTTTTCCCTTTCCTTGGCACTTTGCCATCACCACCCGCT IGK T F F T IGKV3-11*01,IGKV3-11*02,IGKV3-20*01 IGKJ2*02,IGKJ2*04 CTGTGTTTGTCTCCTGAGGCATGGGACCCAGGGTGAGGATATCCCAGGGAAATGGCACTTTTG CTGTCTTTGTCTCCAGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCACTTTTG LCLSPEAWDPG*GYPREMALL LSLSPGXXXXXXXXXXXXALL 1 19 55 63 CTGTGTTTGTCTCCTGAGG LCLSPE CTGTCTTTGTCTCCAGGGG LSLSPG GCACTTTTG ALL GCACTTTTG ALL CTGTGTTTGTCTCCTGAGG LCLSPE 22.092 17.992 15S30N19M176S238N 69S2N9M132S27N 5.678e+00 8.488e-01 84.211 100.000 16 34 31 49 70 78 3 11 16 34 CATGGGACCCAGGGTGAGGATATCCCAGGGAAATG 35
TRDV1*01 TTGGGACCCAGGGTGAGGATATCCCAGGGAAATGGCACTTTTGCCCCTGCAGTTTTTGTACAGGTCTCTGTAGGTTTTGTAGCACTGTGCGTATCCCCCAGTACAGGGGGGTGTCACAGGCACAGTAGTAAGACCCTTCATCTCTCTCTGATGGTGCAAGTATCTTAAGTACAGCCAGGTTCTTTGCAATATCGATTC IGH T F T IGLV2-5*01,IGLV2-5*02 IGHD2-8*02 CAGGCACAGTAGTAAGACCCTTCATCTCTCTCTGATGGTG CAGGCACAGTCCCCAAACCCATGATCTNNNNCTGGTGGTG QAQ**DPSSLSDG QAQSPNP*SXXGG 1 27 32 40 CAGGCACAGTAGTAAGACCCTTCATCT QAQ**DPSS CAGGCACAGTCCCCAAACCCATGATCT QAQSPNP*S CTGATGGTG DG CTGGTGGTG GG 22.092 12.223 116S124N27M55S147N 147S11N9M42S11N 5.306e+00 2.063e+01 74.074 88.889 117 143 125 151 148 156 12 20 CTCT 4
TRDV1*01 GGCAAAAGCATTCTAGGTACACTGAAAAATAATTCAAGGGAAGAAGCCATTGCTGATCAAAATCAAGGATGGCTAGAAACACTTACTTGCAATCACAGAAAGTCTTGTGCCCTTTCCAAAGACAAGAGGTGTGTTTCCTTAGGACCCAAGAGCACAAAAGTACTTTGCTGAATCTTCTAGCTGTAAGGCTGAAATGGTTAAGGCGACGGATTTCGCTGCTTTCTTGAAGTTGACAGAATAGCGACCACTTTTTGCATTGGGACCAGGGTGAGGATATCCCAGGGAAATGGCACTTTTGCCCCTGCAGTTTTTGTACAGGTCTCTGTAGGTTTTGTAGCACTGTGCCCACAATGAAACACATCAGTATAAAAACCCTCTTCTTCCTTTTCCCTTCCTTGGCATTTGCCATCACCACCCGCT IGK F F F T IGKV2-18*01,IGKV2D-18*01 IGKJ2*02,IGKJ2*04 CTTTTTGCATTGGGACCAGGGTGAGGATATCCCAGGGAAATGGCACTTTTG CTATTTGCATTGGTACCNNNNNNNNNNNNNNNNNNNNNNNNNGCACTTTTG FLHWDQGEDIPGKWHF YLHWYXXXXXXXXXHF 1 17 43 51 CTTTTTGCATTGGGACC FLHWD CTATTTGCATTGGTACC YLHWY GCACTTTTG HF GCACTTTTG HF CTTT F TTGCATTGGGACC LHWD 22.092 17.992 247S107N17M156S178N 289S2N9M122S27N 1.212e+01 1.686e+00 88.235 100.000 248 264 108 124 290 298 3 11 248 251 252 264 AGGGTGAGGATATCCCAGGGAAATG 25
Total queries = 14
Total identifiable CDR3 = 4
Total unique clonotypes = 4
Clonotype summary. A particular clonotype includes any V(D)J rearrangements that have the same germline V(D)J gene segments,
the same productive/non-productive status and the same CDR3 nucleotide as well as amino sequence (Those having the same
CDR3 nucleotide but different amino acid sequence or productive/non-productive status due to frameshift in V or J gene
are assigned to a different clonotype. However, they share the same identifier prefix, for example, 6a, 6b).
1 IGLV2-14*01 12/4/0 IGLJ3*02 [IGL] 1 25 AGCTCATATACAAGCTTTCTTGGGTG AHIQAFLG No IGLV2-14*01 N/A IGLJ3*02
2 IGKV1-5*03 9/4/1 IGKJ1*01 [IGK] {CQQYNRLWTF} 1 25 CAACAATATAATAGACTTTGGACG QQYNRLWT Yes IGKV1-5*03 N/A IGKJ1*01
3 IGHV3-74*02 7/CCGCGGT/6 IGHD3-9*01 4/CTTCGAAC 1 25 CGCGGTCGATATTTTGACTGGTTATTACTTCGAACATGACTAC RGRYFDWLLLRT*L No IGHV3-74*01,IGHV3-74*02 IGHD3-9*01 IGHJ4*02
4 TRBV11-2*01 1/4/0 TRBJ2-7*01 [TRB] {CASSLGPSY 1 25 GCCAGCAGCTTAGGTCCCTCGTACGAGCAGTACTTCG PAA*VPRTSSTS No IGHV3-72*01 IGHD2-2*01,IGHD2-2*02,IGHD2-2*03 IGHJ2*01
All query sequence(s) grouped by clonotypes. Identity refers to similarity between the query and top germline V gene
1 1 25 99.6 99.6 99.6 IGLV2-14*01 12/4/0 IGLJ3*02 [IGL]
2 1 25 95.7 95.7 95.7 IGKV1-5*03 9/4/1 IGKJ1*01 [IGK] {CQQYNRLWTF}
3 1 25 99.6 99.6 99.6 IGHV3-74*02 7/CCGCGGT/6 IGHD3-9*01 4/CTTCGAAC
4 1 25 81.8 81.8 81.8 TRBV11-2*01 1/4/0 TRBJ2-7*01 [TRB] {CASSLGPSY
{
"samples": {
"number": 3,
"original_names": [
"file_1.fastq",
"file_2.fastq",
"file_3.fastq"
],
"commandline": [
"vidjil-algo -w 60 -c clones -3 -y all -z all -r 5 -g germline/homo-sapiens.g file_1.fastq ",
"vidjil-algo -w 60 -c clones -3 -y all -z all -r 5 -g germline/homo-sapiens.g file_2.fastq ",
"vidjil-algo -w 60 -c clones -3 -y all -z all -r 5 -g germline/homo-sapiens.g file_3.fastq "
],
"log": [
"Log file 1",
"Log file 2",
"Log file 3"
],
"producer": [
"vidjil-algo dev 6eb6527f (2018-07-11)",
"vidjil-algo dev 6eb6527f (2018-07-11)",
"vidjil-algo dev 6eb6527f (2018-07-11)"
],
"run_timestamp": [
"2019-01-24 10:39:25",
"2019-01-24 10:43:20",
"2019-01-24 10:57:43"
],
"timestamp": [
"2019-10-15 16:05:59",
"2019-10-15 16:05:43",
"2019-10-15 16:05:51"
]
},
"reads": {
"total": [
250,
500,
2000
],
"segmented": [
250,
500,
1940
],
"germline": {
"IGH": [
200,
500,
1940
],
"IGK": [
0,
0,
0
],
"TRD": [
50,
0,
0
]
}
},
"clones": [
{
"reads": [
50, 95, 200
],
"_average_read_length": [
162.15, 182.0, 158.0
],
"germline": "IGH",
"id": "IGH_top_1",
"name": "T1 - IGHV1*01 0//0 IGHJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 1,
"warn": [
{
"code": "W69",
"level": "warn",
"msg": "Several genes with equal probability: TRBD2*01 TRBD2*02"
}
]
},
{
"reads": [
30, 75, 125
],
"_average_read_length": [
162.0, 182.0, 162.0
],
"germline": "IGH",
"id": "IGH_top_2",
"name": "T2 - IGHV1*01 0//0 IGHJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 2
},
{
"reads": [
25, 0, 150
],
"_average_read_length": [
164.0, 184.0, 160.0
],
"germline": "IGH",
"id": "IGH_top_3",
"name": "T3 - IGHV1*01 0//0 IGHJ2*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ2*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 3
},
{
"reads": [
25, 50, 125
],
"_average_read_length": [
164.0, 184.0, 164.0
],
"germline": "IGH",
"id": "IGH_top_4",
"name": "T4 - IGHV2*01 0//0 IGHJ2*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ2*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV2*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 4
},
{
"reads": [
15, 50, 75
],
"_average_read_length": [
160.0, 180.0, 160.0
],
"germline": "IGH",
"id": "IGH_top_5",
"name": "T5 - IGHV3*01 0//0 IGHJ3*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ3*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV3*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 5
},
{
"reads": [
15, 35, 70
],
"_average_read_length": [
164.0, 184.0, 164.0
],
"germline": "IGH",
"id": "IGH_top_6",
"name": "T6 - IGHV1*01 0//0 IGHJ4*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ4*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 6
},
{
"reads": [
10, 25, 65
],
"_average_read_length": [
160.0, 180.0, 160.0
],
"germline": "IGH",
"id": "IGH_top_7",
"name": "T7 - IGHV2*01 0//0 IGHJ2*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ2*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV2*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 7
},
{
"reads": [
10, 25, 55
],
"_average_read_length": [
160.0, 182.0, 162.0
],
"germline": "IGH",
"id": "IGH_top_8",
"name": "T8 - IGHV3*01 0//0 IGHJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV3*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 8
},
{
"reads": [
10, 25, 55
],
"_average_read_length": [
162.0, 182.0, 162.0
],
"germline": "IGH",
"id": "IGH_top_9",
"name": "T9 - IGHV1*01 0//0 IGHJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 9
},
{
"reads": [
10, 20, 50
],
"_average_read_length": [
162.0, 182.0, 162.0
],
"germline": "IGH",
"id": "IGH_top_10",
"name": "T10 - IGHV1*01 0//0 IGHJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "IGHJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "IGHV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 10
},
{
"reads": [
10, 0, 0
],
"_average_read_length": [
172.0, 172.0, 168.0
],
"germline": "TRD",
"id": "TRD_top_1",
"name": "T11 - TRDV1*01 // TRDJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "TRDJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "TRDV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 11
},
{
"reads": [
10, 0, 0
],
"_average_read_length": [
172.0, 172.0, 168.0
],
"germline": "TRD",
"id": "TRD_top_2",
"name": "T12 - TRDV1*01 // TRDJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "TRDJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "TRDV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 12
},
{
"reads": [
10, 0, 0
],
"_average_read_length": [
173.0, 173.0, 170.0
],
"germline": "TRD",
"id": "TRD_top_3",
"name": "T13 - TRDV1*01 // TRDJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "TRDJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "TRDV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 13
},
{
"reads": [
10, 0, 0
],
"_average_read_length": [
171.0, 171.0, 171.0
],
"germline": "TRD",
"id": "TRD_top_4",
"name": "T14 - TRDV1*01 // TRDJ2*01",
"seg": {
"3": {
"delLeft": 14,
"name": "TRDJ2*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "TRDV1*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 14
},
{
"reads": [
10, 0, 0
],
"_average_read_length": [
172.0, 174.0, 172.0
],
"germline": "TRD",
"id": "TRD_top_5",
"name": "T15 - TRDV2*01 // TRDJ1*01",
"seg": {
"3": {
"delLeft": 14,
"name": "TRDJ1*01",
"start": 97
},
"5": {
"delRight": 8,
"name": "TRDV2*01",
"stop": 96
}
},
"sequence": "AGGGGTATTGTGGATGGCAGCGGGTGGTGATGGCAAAGTGCCAAGGAAAGGGAAAAAGGAAGAAGAGGGTTTTTATACTGATGTGTTTCATTGTGCACAGTGCTACAAAACCTACAGAGACCTGTACAAAAACTGCAGGGGCAAAAGTGCCATTTCCCTGGG",
"top": 15
}
],
"clusters": [
0
],
"germlines": {},
"vidjil_json_version": "2016b",
"producer": "vidjil fuse",
"timestamp": "2019-10-15 16:07:49",
"categories": [
{
"pospcell": "Thymus",
"runs": 2
},
{
"pospcell": "Thymus",
"runs": 2
},
{
"pospcell": "Thymus",
"runs": 3
}
],
"similarity": [],
"diversity": {
"index_H_entropy": [
10.903865873024188,
11.175345627943898,
9.471138702527242
],
"index_E_equitability": [
0.8133112788200378,
0.8387792110443115,
0.7157883048057556
],
"index_Ds_diversity": [
0.9999576807022095,
0.9999671578407288,
0.9998804926872253
]
},
"distributions": {
"repertoires": {
"file_1.fastq": [
{
"axes": [
"lenSeqAverage"
],
"values": {
"160.0": [
3,
35
],
"162.0": [
4,
100
],
"164.0": [
3,
65
],
"171.0": [
1,
10
],
"172.0": [
3,
30
],
"173.0": [
1,
10
]
}
},
{
"axes": [
"lenCDR3"
],
"values": {
"unknow_axis": [
25,
250
]
}
},
{
"axes": [
"seg5",
"seg3"
],
"values": {
"IGHV1*01": {
"IGHJ1*01": [
4,
100
],
"IGHJ2*01": [
1,
25
],
"IGHJ4*01": [
1,
15
]
},
"IGHV2*01": {
"IGHJ2*01": [
2,
35
]
},
"IGHV3*01": {
"IGHJ1*01": [
1,
10
],
"IGHJ3*01": [
1,
15
]
},
"TRDV1*01": {
"TRDJ1*01": [
3,
30
],
"TRDJ2*01": [
1,
10
]
},
"TRDV2*01": {
"TRDJ1*01": [
1,
10
]
}
}
}
],
"file_2.fastq": [
{
"axes": [
"lenSeqAverage"
],
"values": {